chemicals , purchase of chemicals , anti-phospho-enos (pser1176) antibody produced in rabbit properties: biological source: rabbit quality level: 100 conjugate: unconjugated antibody form: affinity isolated antibody antibody product type: primary antibodies clone: polyclonal form: buffered aqueous solution mol wt.: antigen 133 kda species reactivity: rat, human, mouse concentration ~1 mg/ml technique elisa: 1:20000 western blot: 1:500-1:1000 ncbi accession no. p29474 uniprot accession no. p29474 storage temp.: -20°c target post-translational modification: phosphorylation (pser1176) gene information: human ... nos3(4846) immunogen: the antiserum was produced against synthesized peptide derived from human enos around the phosphorylation site of ser1176. immunogen range: 1144-1193 physical form: rabbit igg in phosphate buffered saline (without mg2+ and ca2+), ph 7.4, 150mm nacl, 0.02% sodium azide and 50% glycerol. , monoclonal anti-hipk1 antibody produced in mouse properties: biological source: mouse quality level: 100 conjugate: unconjugated antibody form: purified immunoglobulin antibody product type: primary antibodies clone: 4c2, monoclonal form: buffered aqueous solution mol. wt.: antigen ~37.11 kda species reactivity: human technique(s): capture elisa: suitable immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable indirect elisa: suitable indirect immunofluorescence: suitable western blot: 1-5 ?g/ml isotype: igg2a? ncbi accession no.: bc028408 uniprot accession no.: q86z02 storage temp.: -20°c target post-translational modification: unmodified gene information: human ... hipk1(204851) immunogen: hipk1 (aah28408, 330 a.a. ~ 430 a.a) partial recombinant protein with gst tag. mw of the gst tag alone is 26 kda. sequence: ctplmvatlhpqvatitpqyavpftlscaagrpalveqtaavlqawpggtqqillpstwqqlpgvalhnsvqptamipeamgsgqqladwrnahshgnqys physical form: solution in phosphate buffered saline, ph 7.4 , anti-nos1 antibody, clone 1f14 zoomab® rabbit monoclonal properties: biological source: rabbit quality level: 200 recombinant: expressed in hek 293 cells conjugate: unconjugated antibody form: purified antibody antibody product type: primary antibodies clone: 1f14, monoclonal; recombinant monoclonal form: lyophilized mol. wt.: calculated mol wt ~160.97 kda; observed mol wt ~165 kda species reactivity: human enhanced validation: recombinant expression technique immunocytochemistry: suitable immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable western blot: suitable isotype: igg uniprot accession no.: p29475 storage temp.: 2-8°c target post-translational modification: unmodified immunogen: his-tagged recombinant fragment corresponding to the first 300 amino acids from the n-terminal region of human nos1. physical form: purified recombinant mouse monoclonal antibody igg, lyophilized in pbs, 5% trehalose, normal appearance a coarse or translucent resin. contains no biocide or preservatives, such as azide, or any animal by-products. larger pack sizes provided as multiples of 25 ?l. reconstitution: 300 ?g/ml after reconstitution at 25 ?l per vial. storage and stability recommend storage of lyophilized product at 2-8°c. reconstituted antibodies can be stored at 2-8°c, or -20°c for long term storage.