chemicals , purchase of chemicals , anti-phospho-enos/nos iii (thr495) antibody, rabbit monoclonal properties: biological source: rabbit quality level: 100 antibody form: culture supernatant antibody product type: primary antibodies clone: monoclonal species reactivity: bovine technique: western blot: suitable isotype: igg,ncbi accession no.: nm_000603 uniprot accession no.: p29474 target post-translational modification: phosphorylation (pthr495) gene information: mouse ... nos3(287024) specificity: predicted cross-reactivity with human, rabbit, mouse and rat recognizes phosphorylated enos/nos iii. immunogen:, peptide containing the sequence kk[pt]fk in which pt corresponds to phosphothreonine at residue 495 of human enos/nos iii application: western blot analysis: 1:2,000-1:10,000 dilution target description: 135 kda,linkage: replaces: 05-811 physical form: cultured supernatant in 0.05% sodium azide , anti-gapdh antibody, mouse monoclonal, gapdh-71.1 properties: biological source: mouse quality level: 200 conjugate: unconjugated antibody form: purified from hybridoma cell culture; purified immunoglobulin hybridoma gapdh-71.1 produced by the fusion of mouse myeloma cells (ns1 cells) and splenocytes from balb/c mice immunized with rabbit gapdh (glyceraldehyde-3-phosphate dehydrogenase). antibody product type: primary antibodies clone: gapdh-71.1, monoclonal form: buffered aqueous solution mol. wt.: antigen ~37 kda species reactivity: bovine, turkey, canine, chicken, monkey, mink, mouse, human, rabbit, rat, hamster should not react with: prokaryotes concentration: ~1 mg/ml technique immunocytochemistry: suitable , indirect elisa: suitable microarray: suitable, western blot: 0.025-0.05 ?g/ml using a431 total cell extract isotype: igm, uniprot accession no.: p04406 application: research pathology, western blot, immunostaining, immunocytochemistry, indirect elisa and microarray. storage temp.: -20°c target post-translational modification: unmodified gene information: human ... gapdh(2597), mouse ... gapdh(14433), rat ... gapdh(24383) specificity: monoclonal anti-gapdh should recognizes human, monkey, bovine, canine, rat, mouse, hamster, mink, rabbit, chicken, and turkey gapdh. it should not cross-react with non-vertebrate and prokaryotic species. immunogen: rabbit gapdh. physical form:,solution in 0.01 m phosphate buffered saline, ph 7.4, containing 15 mm sodium azide. storage and stability:, for continuous use, storage at 2-8°c for up to one month. for extended storage: -20°c , anti-hipk2 antibody, clone 3z5p6, rabbit monoclonal biological source: rabbit quality level: 100 material: colorless clone: 3z5p6, monoclonal form: liquid species reactivity: human concentration: 0.3mg/ml technique(s): immunofluorescence: 1:50 - 1:200 western blot: 1:500 - 1:2000 color: colorless isotype: igg immunogen sequence stsvtgqvlggphnlmrrstvslldtyqkcglkrkseeientssvqiieehppmiqnnasgatvatattstatsknsgsnsegdyqlvqhevlcsmtntye uniprot accession no.: q9h2x6 storage temp.: -20°c target post-translational modification: unmodified gene information: human ... hipk2 (28996) immunogen: a synthetic peptide corresponding to a sequence within amino acids 100-200 of human hipk2 (q9h2x6). physical form: pbs with 0.02% sodium azide, 0.05% bsa, 50% glycerol, ph7.3. application wb, if/icc