}
  • Home   ›
  •   Indian Tenders   › Tender Notice : 49583642

    • Tender For Supply Of Following-Multi State

    Presidency University has published Tender For Supply Of Following. Submission Date for this Tender is 16-06-2025. Laboratory Equipment Tenders in Multi State. Bidders can get complete Tender details and download the document.




    Tender Notice

    49583642
    Tender For Supply Of Following
    Tender
    Indian
    Multi State
    16-06-2025

    Tender Details

    Tender For Supply Of Following - Fourteen (14) synthetic custom peptides each of >95% purity as checked by mass spectrometry. Peptide names and their sequence (N-C) are given below: P1: GYFADPKDPHKFYICSNWEA P2:VHKDCPGNTRWNEDEETCT P3: NHEIKKVLVPGCHGSEPCIIHRGK P4: RGKPFQLEAVFEANQNTKTAKIEIK P5: LEVDVPGIDPNACHYMKCPLVKGQQYDIK P6: YDIKYTWNVPKIAPKSENVVVTVKVMGDD P7: YRNSQLDLAEQELVDCASQHGCHGDTI P8: RRPNAQRFGISNYCQIYPPNVNKIREALAQTH P9: YWIVRNSWDTNWGDNGYGYFAANID P10: KDLDAFRHYDGRTIIQRDNGYQPNY P11: KAEQELVPFQLEAVFQHGCHGDTIR P12: DVPGIDPNACHYMKNTRWNEDEETCT P13: KVLVPGCHGSEPCIIHRRRPNAQRFGISNY P14: KLVDCLARWSKKDVDDLIKAAVDCQIYP Expression, purification from inclusion bodies, and refolding of two customrecombinant proteins Der p 1 and Der p 2. Refolded proteins need to be purified again in Size exclusion column and supplied to us at >2 mg/ml concentration in about 10 ml volume. Plasmid constructs of these two genes will be provided by our lab to the vendor/company.

    Key Value

    Document Fees
    Refer document
    EMD
    Refer document
    Need MSME Loan? Apply Now
    Tender Value
    Refer document
    RBbranding
    Disclaimer :
    We takes all possible care for accurate & authentic tender information, however Users are requested to refer Original source of Tender Notice / Tender Document published by Tender Issuing Agency before taking any call regarding this tender.
    Tell us about your Product / Services,
    We will Find Tenders for you
    RBTendersdetails2
    Cnet Technologies

    We are a group of professionals specializing in custom software development, web development, mobile app development, IOT base solutions, web design, graphics & Enterprise solutions provid.

    About Us

    Services

    Browse Tenders

    For Sales Inquiry

    Connect With Us

    Copyright © 2025 · All Rights Reserved. Terms of Usage | Privacy Policy

    For Tender Information Services Visit : TenderDetail